| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50018894 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1364479 (CHEMBL3295027) |
|---|
| IC50 | 76±n/a nM |
|---|
| Citation |  Johnson, MG; Liu, JJ; Li, AR; van Lengerich, B; Wang, S; Medina, JC; Collins, TL; Danao, J; Seitz, L; Willee, A; D'Souza, W; Budelsky, AL; Fan, PW; Wong, SG Solving time-dependent CYP3A4 inhibition for a series of indole-phenylacetic acid dual antagonists of the PGD(2) receptors CRTH2 and DP. Bioorg Med Chem Lett24:2877-80 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50018894 |
|---|
| n/a |
|---|
| Name | BDBM50018894 |
|---|
| Synonyms: | CHEMBL3287086 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22Cl2N2O6S |
|---|
| Mol. Mass. | 549.423 |
|---|
| SMILES | COc1cc(CC(O)=O)ccc1Oc1ccc2n(C)c(C)cc2c1NS(=O)(=O)c1ccc(Cl)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
