| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Matrix protein 2 |
|---|
| Ligand | BDBM50020754 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1364624 (CHEMBL3291757) |
|---|
| IC50 | 5540±n/a nM |
|---|
| Citation |  Rey-Carrizo, M; Barniol-Xicota, M; Ma, C; Frigolé-Vivas, M; Torres, E; Naesens, L; Llabrés, S; Juárez-Jiménez, J; Luque, FJ; DeGrado, WF; Lamb, RA; Pinto, LH; Vázquez, S Easily accessible polycyclic amines that inhibit the wild-type and amantadine-resistant mutants of the M2 channel of influenza A virus. J Med Chem57:5738-47 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Matrix protein 2 |
|---|
| Name: | Matrix protein 2 |
|---|
| Synonyms: | M | M2_I72A8 | Proton channel protein M2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11180.06 |
|---|
| Organism: | Influenza A virus (A/Udorn/307/1972(H3N2)) |
|---|
| Description: | ChEMBL_22 |
|---|
| Residue: | 97 |
|---|
| Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE
|
|
|
|---|
| BDBM50020754 |
|---|
| n/a |
|---|
| Name | BDBM50020754 |
|---|
| Synonyms: | CHEMBL3286976 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16ClN |
|---|
| Mol. Mass. | 209.715 |
|---|
| SMILES | Cl.C1NCC2C1C1C=CC2C2C=CC12 |c:7,12,TLB:1:5:8.7:13.10,THB:3:4:8.7:13.10,11:10:8.7:4.5,12:13:8.7:4.5| |
|---|
| Structure | 
|
|---|
Search and Browse
