Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 1
LigandBDBM50027956
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1436858
EC50 2100±n/a nM
Citation Horan JCSanyal SChoi YHill-Drzewi MPatnaude LAnderson SFogal SMao CCook BNGueneva-Boucheva KFisher MBHickey EPack EBannen LCChan DSMac MBNg SMWang YXu WModis LKLemieux RM Piperazinyl-oxadiazoles as selective sphingosine-1-phosphate receptor agonists. Bioorg Med Chem Lett 24:4807-11 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 1
Name:Sphingosine 1-phosphate receptor
Synonyms:CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1
Type:Enzyme
Mol. Mass.:42836.02
Organism:Homo sapiens (Human)
Description:P21453
Residue:382
Sequence:
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027956
n/a
NameBDBM50027956
Synonyms:CHEMBL3344436
TypeSmall organic molecule
Emp. Form.C23H27ClFN5O4
Mol. Mass.491.943
SMILESOC(=O)C1CN(Cc2cc(Cl)c(cc2F)-c2nc(no2)N2CCN(CC2)C(=O)C2CCCC2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: