Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM50030759
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1437736
Ki 150±n/a nM
Citation Tao ZFHasvold LWang LWang XPetros AMPark CHBoghaert ERCatron NDChen JColman PMCzabotar PEDeshayes KFairbrother WJFlygare JAHymowitz SGJin SJudge RAKoehler MFKovar PJLessene GMitten MJNdubaku CONimmer PPurkey HEOleksijew APhillips DCSleebs BESmith BJSmith MLTahir SKWatson KGXiao YXue JZhang HZobel KRosenberg SHTse CLeverson JDElmore SWSouers AJ Discovery of a Potent and Selective BCL-XL Inhibitor with in Vivo Activity. ACS Med Chem Lett 5:1088-93 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030759
n/a
NameBDBM50030759
Synonyms:CHEMBL3342194
TypeSmall organic molecule
Emp. Form.C33H28N6O4S2
Mol. Mass.636.743
SMILESOC(=O)c1nc(sc1CCCOc1ccc(cc1)-n1cccn1)N1CCc2cccc(C(=O)Nc3nc4ccccc4s3)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: