Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3
LigandBDBM50031495
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1438566
EC50 1.6±n/a nM
Citation Testa CScrima MGrimaldi MD'Ursi AMDirain MLLubin-Germain NSingh AHaskell-Luevano CChorev MRovero PPapini AM 1,4-disubstituted-[1,2,3]triazolyl-containing analogues of MT-II: design, synthesis, conformational analysis, and biological activity. J Med Chem 57:9424-34 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3
Name:Melanocortin receptor 3
Synonyms:MC3-R
Type:PROTEIN
Mol. Mass.:35808.24
Organism:Mus musculus
Description:ChEMBL_1498848
Residue:323
Sequence:
MNSSCCLSSVSPMLPNLSEHPAAPPASNRSGSGFCEQVFIKPEVFLALGIVSLMENILVI
LAVVRNGNLHSPMYFFLCSLAAADMLVSLSNSLETIMIAVINSDSLTLEDQFIQHMDNIF
DSMICISLVASICNLLAIAIDRYVTIFYALRYHSIMTVRKALTLIGVIWVCCGICGVMFI
IYSESKMVIVCLITMFFAMVLLMGTLYIHMFLFARLHVQRIAVLPPAGVVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFKEILCGCNSMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50031495
n/a
NameBDBM50031495
Synonyms:CHEMBL3358536
TypeSmall organic molecule
Emp. Form.C51H73N17O8
Mol. Mass.1052.2344
SMILESCCCCCC[C@H](NC(=O)[C@H](CCCC)NC(C)=O)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CN=[N+]=[N-])C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: