Reaction Details |
| Report a problem with these data |
Target | Dihydropteroate synthase |
---|
Ligand | BDBM50108009 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1440910 (CHEMBL3375174) |
---|
Kd | 76200±n/a nM |
---|
Citation | Dennis, ML; Chhabra, S; Wang, ZC; Debono, A; Dolezal, O; Newman, J; Pitcher, NP; Rahmani, R; Cleary, B; Barlow, N; Hattarki, M; Graham, B; Peat, TS; Baell, JB; Swarbrick, JD Structure-based design and development of functionalized Mercaptoguanine derivatives as inhibitors of the folate biosynthesis pathway enzyme 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase from Staphylococcus aureus. J Med Chem57:9612-26 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydropteroate synthase |
---|
Name: | Dihydropteroate synthase |
Synonyms: | Bacterial dihydropteroate synthase | DHPS_ECOLI | Dihydropteroate synthase | dhpS | folP |
Type: | PROTEIN |
Mol. Mass.: | 30611.24 |
Organism: | Escherichia coli (strain K12) |
Description: | ChEMBL_1440910 |
Residue: | 282 |
Sequence: | MKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHANLMINAGATIIDVGGE
STRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRESAKVGAHIINDIRSL
SEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEQAGIAKE
KLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIGQLLNVGPSERLSGSL
ACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
|
|
|
BDBM50108009 |
---|
n/a |
---|
Name | BDBM50108009 |
Synonyms: | 2-Amino-8-mercapto-1,9-dihydro-purin-6-one | 2-amino-8-mercapto-1H-purin-6(9H)-one | 2-amino-8-sulfanyl-1,9-dihydro-6H-purin-6-one | CHEMBL178006 | CHEMBL46065 |
Type | Small organic molecule |
Emp. Form. | C5H5N5OS |
Mol. Mass. | 183.191 |
SMILES | Nc1nc2[nH]c(=S)[nH]c2c(=O)[nH]1 |
Structure |
|