Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepsin
LigandBDBM50032939
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1432692
Ki 1.2±n/a nM
Citation Han ZHarris PKJones DEChugani RKim TAgarwal MShen WWildman SAJanetka JW Inhibitors of HGFA, Matriptase, and Hepsin Serine Proteases: A Nonkinase Strategy to Block Cell Signaling in Cancer. ACS Med Chem Lett 5:1219-24 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hepsin
Name:Hepsin
Synonyms:Serine protease hepsin | Transmembrane protease, serine 1
Type:Enzyme
Mol. Mass.:45016.98
Organism:Homo sapiens (Human)
Description:Human deglycosylated hepsin was expressed in Pichia pastoris.
Residue:417
Sequence:
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032939
n/a
NameBDBM50032939
Synonyms:CHEMBL3356598
TypeSmall organic molecule
Emp. Form.C26H45N9O6S
Mol. Mass.611.757
SMILESCC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(C)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)c1nccs1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: