Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatocyte growth factor activator
LigandBDBM50032942
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1432690
Ki 57±n/a nM
Citation Han ZHarris PKJones DEChugani RKim TAgarwal MShen WWildman SAJanetka JW Inhibitors of HGFA, Matriptase, and Hepsin Serine Proteases: A Nonkinase Strategy to Block Cell Signaling in Cancer. ACS Med Chem Lett 5:1219-24 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hepatocyte growth factor activator
Name:Hepatocyte growth factor activator
Synonyms:HGF activator | HGFA | HGFAC | Hepatocyte growth factor activator | Hepatocyte growth factor activator long chain | Hepatocyte growth factor activator short chain
Type:PROTEIN
Mol. Mass.:70690.18
Organism:Homo sapiens (Human)
Description:ChEMBL_109514
Residue:655
Sequence:
MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50032942
n/a
NameBDBM50032942
Synonyms:CHEMBL3356601
TypeSmall organic molecule
Emp. Form.C29H43N9O6S
Mol. Mass.645.773
SMILESCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)c1nccs1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: