Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein Coupled Receptor 54
LigandBDBM50045514
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1448385
Ki 0.026000±n/a nM
Citation Asami TNishizawa NMatsui HTakatsu YSuzuki AKiba ATerada MNishibori KNakayama MBan JMatsumoto STarui NIkeda YYamaguchi MKusaka MOhtaki TKitada C Physicochemically and pharmacokinetically stable nonapeptide KISS1 receptor agonists with highly potent testosterone-suppressive activity. J Med Chem 57:6105-15 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein Coupled Receptor 54
Name:G-protein Coupled Receptor 54
Synonyms:G-protein coupled receptor 54 (GPR54) | Hypogonadotropin-1 | KiSS-1R | Kisspeptins receptor | Metastin receptor | hOT7T175
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42613.79
Organism:Homo sapiens (Human)
Description:Binding assay was performed using membranes from the CHO cell transfectants.
Residue:398
Sequence:
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN
SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL
HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP
ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA
AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH
AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50045514
n/a
NameBDBM50045514
Synonyms:CHEMBL3315315
TypeSmall organic molecule
Emp. Form.C65H84N18O14
Mol. Mass.1341.4747
SMILESCC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: