| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50055065 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1447934 (CHEMBL3379237) |
|---|
| Ki | 818±n/a nM |
|---|
| Citation |  Bourgeois, C; Werfel, E; Galla, F; Lehmkuhl, K; Torres-Gómez, H; Schepmann, D; Kögel, B; Christoph, T; Straßburger, W; Englberger, W; Soeberdt, M; Hüwel, S; Galla, HJ; Wünsch, B Synthesis and pharmacological evaluation of 5-pyrrolidinylquinoxalines as a novel class of peripherally restricted¿-opioid receptor agonists. J Med Chem57:6845-60 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50055065 |
|---|
| n/a |
|---|
| Name | BDBM50055065 |
|---|
| Synonyms: | CHEMBL3323512 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H29Cl2N3O2 |
|---|
| Mol. Mass. | 426.38 |
|---|
| SMILES | CN1CCN(C2C(CCCC12)N1CCC(O)C1)C(=O)Cc1ccc(Cl)c(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
