Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50055066 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1447934 (CHEMBL3379237) |
---|
Ki | 518±n/a nM |
---|
Citation | Bourgeois, C; Werfel, E; Galla, F; Lehmkuhl, K; Torres-Gómez, H; Schepmann, D; Kögel, B; Christoph, T; Straßburger, W; Englberger, W; Soeberdt, M; Hüwel, S; Galla, HJ; Wünsch, B Synthesis and pharmacological evaluation of 5-pyrrolidinylquinoxalines as a novel class of peripherally restricted¿-opioid receptor agonists. J Med Chem57:6845-60 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50055066 |
---|
n/a |
---|
Name | BDBM50055066 |
Synonyms: | CHEMBL3323513 |
Type | Small organic molecule |
Emp. Form. | C24H35Cl2N3O |
Mol. Mass. | 452.46 |
SMILES | CCCCN1CCN(C2C(CCCC12)N1CCCC1)C(=O)Cc1ccc(Cl)c(Cl)c1 |
Structure |
|