| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50009307 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1460710 (CHEMBL3396041) |
|---|
| Ki | 70±n/a nM |
|---|
| Citation |  Sozio, P; Fiorito, J; Di Giacomo, V; Di Stefano, A; Marinelli, L; Cacciatore, I; Cataldi, A; Pacella, S; Turkez, H; Parenti, C; Rescifina, A; Marrazzo, A Haloperidol metabolite II prodrug: asymmetric synthesis and biological evaluation on rat C6 glioma cells. Eur J Med Chem90:1-9 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50009307 |
|---|
| n/a |
|---|
| Name | BDBM50009307 |
|---|
| Synonyms: | DITOLYLGUANIDINE | Di-o-tolylguanidine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H17N3 |
|---|
| Mol. Mass. | 239.3156 |
|---|
| SMILES | Cc1ccccc1NC(=N)Nc1ccccc1C |
|---|
| Structure | 
|
|---|
Search and Browse
