Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50062499
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1462819
Ki 1530±n/a nM
Citation Bertini SParkkari TSavinainen JRArena CSaccomanni GSaguto SLigresti AAllarÓ MBruno AMarinelli LDi Marzo VNovellino EManera CMacchia M Synthesis, biological activity and molecular modeling of new biphenylic carboxamides as potent and selective CB2 receptor ligands. Eur J Med Chem 90:526-36 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50062499
n/a
NameBDBM50062499
Synonyms:CHEMBL3397449
TypeSmall organic molecule
Emp. Form.C22H27NO2
Mol. Mass.337.4553
SMILESCOc1c(C)cc(cc1C(=O)N[C@H]1CC[C@H](C)CC1)-c1ccccc1 |r,wU:15.16,wD:12.12,(-7.74,3.22,;-6.68,3.84,;-5.34,3.08,;-4.01,3.85,;-4.01,5.08,;-2.67,3.08,;-2.67,1.54,;-4,.77,;-5.34,1.54,;-6.67,.76,;-7.74,1.37,;-6.66,-.78,;-7.99,-1.56,;-9.33,-.79,;-10.66,-1.56,;-10.66,-3.1,;-11.72,-3.72,;-9.32,-3.87,;-7.99,-3.1,;-1.33,.77,;,1.54,;1.33,.77,;1.33,-.77,;,-1.54,;-1.33,-.77,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: