Reaction Details |
| Report a problem with these data |
Target | Matrix protein 2 [1-96] |
---|
Ligand | BDBM50079995 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1471014 (CHEMBL3420061) |
---|
IC50 | 2600±n/a nM |
---|
Citation | Rey-Carrizo, M; Gazzarrini, S; Llabrés, S; Frigolé-Vivas, M; Juárez-Jiménez, J; Font-Bardia, M; Naesens, L; Moroni, A; Luque, FJ; Vázquez, S New polycyclic dual inhibitors of the wild type and the V27A mutant M2 channel of the influenza A virus with unexpected binding mode. Eur J Med Chem96:318-29 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Matrix protein 2 [1-96] |
---|
Name: | Matrix protein 2 [1-96] |
Synonyms: | M | M2_I72A2 | Matrix protein 2 |
Type: | PROTEIN |
Mol. Mass.: | 11051.96 |
Organism: | Influenza A virus |
Description: | ChEMBL_1453980 |
Residue: | 96 |
Sequence: | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRFFEHGLK
RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIEL
|
|
|
BDBM50079995 |
---|
n/a |
---|
Name | BDBM50079995 |
Synonyms: | CHEMBL3415947 |
Type | Small organic molecule |
Emp. Form. | C16H19N |
Mol. Mass. | 225.3288 |
SMILES | [H][C@]12[C@@]3([H])[C@@]4([H])[C@@]1([H])[C@]1([H])[C@@]5([H])CNC[C@@]5([H])[C@@]4([H])[C@@]4([H])[C@]3([H])C=C[C@]2([H])[C@@]14[H] |r,c:27,TLB:21:19:8:25.1,2:1:17.19.4:8,25:27:4.6:10.15,1:2:17:8.27.6,10:8:17:21.2,10:8:17.19.4:25.1,14:15:19.27:4.6,THB:12:10:19.27:4.6,21:19:4.6:10.15,23:21:17:8.27.6,2:4:8:25.1,2:4:19.27:10.15,25:27:17:21.2,24:25:17.19.4:8,1:6:17:21.2,1:6:19.27:10.15| |
Structure |
|