| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50088509 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1484139 (CHEMBL3537145) |
|---|
| IC50 | >2000±n/a nM |
|---|
| Citation |  Bylund, J; Annas, A; Hellgren, D; Bjurström, S; Andersson, H; Svanhagen, A Amide hydrolysis of a novel chemical series of microsomal prostaglandin E synthase-1 inhibitors induces kidney toxicity in the rat. Drug Metab Dispos41:634-41 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 17112.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 152 |
|---|
| Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
|---|
| BDBM50088509 |
|---|
| n/a |
|---|
| Name | BDBM50088509 |
|---|
| Synonyms: | CHEMBL3527201 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21F3N2O6S2 |
|---|
| Mol. Mass. | 518.526 |
|---|
| SMILES | CC(C)C#Cc1ccc(cc1OCCC(F)(F)F)C(=O)NS(=O)(=O)c1ccccc1S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
