Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50090760 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1498309 (CHEMBL3583932) |
---|
Ki | 80±n/a nM |
---|
Citation | Cueva, JP; Roche, C; Ostovar, M; Kumar, V; Clark, MJ; Hillhouse, TM; Lewis, JW; Traynor, JR; Husbands, SM C7ß-methyl analogues of the orvinols: the discovery of kappa opioid antagonists with nociceptin/orphanin FQ peptide (NOP) receptor partial agonism and low, or zero, efficacy at mu opioid receptors. J Med Chem58:4242-9 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50090760 |
---|
n/a |
---|
Name | BDBM50090760 |
Synonyms: | CHEMBL3581750 | US9259422, 30, R = Ph-BU10119 | US9480684, 30, R = Ph- BU10119 |
Type | Small organic molecule |
Emp. Form. | C31H37NO4 |
Mol. Mass. | 487.6298 |
SMILES | [H][C@@]12Oc3c4c(C[C@@]5([H])N(CC6CC6)CC[C@@]14[C@@]51CC[C@@]2(OC)[C@](C)(C1)[C@H](O)c1ccccc1)ccc3O |r,TLB:26:23:16.1:18.19,THB:10:9:17:4.5.6,24:23:16.1:18.19| |
Structure |
|