Reaction Details |
| Report a problem with these data |
Target | Eukaryotic translation initiation factor 4E |
---|
Ligand | BDBM50110896 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1511841 (CHEMBL3608043) |
---|
IC50 | 3680±n/a nM |
---|
Citation | Ziemniak, M; Kowalska, J; Lukaszewicz, M; Zuberek, J; Wnek, K; Darzynkiewicz, E; Jemielity, J Phosphate-modified analogues of m(7)GTP and m(7)Gppppm(7)G-Synthesis and biochemical properties. Bioorg Med Chem23:5369-81 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Eukaryotic translation initiation factor 4E |
---|
Name: | Eukaryotic translation initiation factor 4E |
Synonyms: | EIF4E | IF4E_RABIT |
Type: | PROTEIN |
Mol. Mass.: | 25047.40 |
Organism: | Oryctolagus cuniculus |
Description: | ChEMBL_1511842 |
Residue: | 217 |
Sequence: | MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
|
|
|
BDBM50110896 |
---|
n/a |
---|
Name | BDBM50110896 |
Synonyms: | CHEMBL3604541 |
Type | Small organic molecule |
Emp. Form. | C12H32N9O12P3S |
Mol. Mass. | 619.422 |
SMILES | [NH4+].[NH4+].[NH4+].[NH4+].C[n+]1cn([C@@H]2O[C@H](CO[P@]([S-])(=O)OP([O-])(=O)CP([O-])([O-])=O)[C@@H](O)[C@H]2O)c2nc(N)nc([O-])c12 |r| |
Structure |
|