Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50118189 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1514756 (CHEMBL3614957) |
---|
Ki | 48±n/a nM |
---|
Citation | Nakajima, R; Yamamoto, N; Hirayama, S; Iwai, T; Saitoh, A; Nagumo, Y; Fujii, H; Nagase, H Synthesis of new opioid derivatives with a propellane skeleton and their pharmacologies: Part 5, novel pentacyclic propellane derivatives with a 6-amide side chain. Bioorg Med Chem23:6271-9 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50118189 |
---|
n/a |
---|
Name | BDBM50118189 |
Synonyms: | CHEMBL3613175 |
Type | Small organic molecule |
Emp. Form. | C30H37ClN2O3 |
Mol. Mass. | 509.079 |
SMILES | Cl.[H][C@]12CC[C@]3([H])N(CC4CC4)CC[C@@]4(C[C@@H]1N(C)C(=O)\C=C\c1ccoc1)c1cc(O)ccc1C[C@@]34C2 |r| |
Structure |
|