Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 2
LigandBDBM50124354
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1520364
IC50 1.000000±n/a nM
Citation Charles MDBrookfield JLEkwuru TCStockley MDunn JRiddick MHammonds TTrivier EGreenland GWong ACCheasty ABoyd SCrighton DOlson MF Discovery, Development, and SAR of Aminothiazoles as LIMK Inhibitors with Cellular Anti-Invasive Properties. J Med Chem 58:8309-13 (2015) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 2
Name:LIM domain kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72238.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1514398
Residue:638
Sequence:
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124354
n/a
NameBDBM50124354
Synonyms:CHEMBL3623439
TypeSmall organic molecule
Emp. Form.C20H14ClN3OS
Mol. Mass.379.863
SMILESOc1ccc(Nc2ncc(s2)-c2ccncc2-c2ccccc2Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: