| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50327238 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1526857 (CHEMBL3636925) |
|---|
| Ki | 6.7±n/a nM |
|---|
| Citation |  Narlawar, R; Werry, EL; Scarf, AM; Hanani, R; Chua, SW; King, VA; Barron, ML; Martins, RN; Ittner, LM; Rendina, LM; Kassiou, M First Demonstration of Positive Allosteric-like Modulation at the Human Wild Type Translocator Protein (TSPO). J Med Chem58:8743-9 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50327238 |
|---|
| n/a |
|---|
| Name | BDBM50327238 |
|---|
| Synonyms: | 2-[2-(4'-Methoxyphenyl)-5,7-dimethylpyrazolo[1,5-a]pyrimidin-3-yl]-N,N-diethylacetamide | CHEMBL480041 | N,N-diethyl-2-(2-(4-methoxyphenyl)-5,7-dimethylpyrazolo[1,5-a]pyrimidin-3-yl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26N4O2 |
|---|
| Mol. Mass. | 366.4567 |
|---|
| SMILES | CCN(CC)C(=O)Cc1c(nn2c(C)cc(C)nc12)-c1ccc(OC)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
