Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Ligand | BDBM50141090 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1549064 (CHEMBL3756857) |
---|
IC50 | 16±n/a nM |
---|
Citation | Aggarwal, S; Mahapatra, MK; Kumar, R; Bhardwaj, TR; Hartmann, RW; Haupenthal, J; Kumar, M Synthesis and biological evaluation of 3-tetrazolo steroidal analogs: Novel class of 5a-reductase inhibitors. Bioorg Med Chem24:779-88 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
Type: | Enzyme |
Mol. Mass.: | 28406.59 |
Organism: | Homo sapiens (Human) |
Description: | P31213 |
Residue: | 254 |
Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
BDBM50141090 |
---|
n/a |
---|
Name | BDBM50141090 |
Synonyms: | CHEMBL3753791 |
Type | Small organic molecule |
Emp. Form. | C22H30N4O |
Mol. Mass. | 366.4998 |
SMILES | [H][C@@]12CCC(C(C)=O)[C@@]1(C)CC[C@@]1([H])[C@@]2([H])CC=C2C=C(CC[C@]12C)c1nnn[nH]1 |r,c:21,t:19| |
Structure |
|