Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranscription intermediary factor 1-alpha
LigandBDBM50148479
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1560318
IC50 1500±n/a nM
Citation Palmer WSPoncet-Montange GLiu GPetrocchi AReyna NSubramanian GTheroff JYau AKost-Alimova MBardenhagen JPLeo EShepard HETieu TNShi XZhan YZhao SBarton MCDraetta GToniatti CJones PGeck Do MAndersen JN Structure-Guided Design of IACS-9571, a Selective High-Affinity Dual TRIM24-BRPF1 Bromodomain Inhibitor. J Med Chem 59:1440-54 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Transcription intermediary factor 1-alpha
Name:Transcription intermediary factor 1-alpha
Synonyms:6.3.2.- | E3 ubiquitin-protein ligase TRIM24 | RING finger protein 82 | RNF82 | TIF1 | TIF1-alpha | TIF1A | TRIM24 | Transcription intermediary factor 1-alpha | Tripartite motif-containing protein 24
Type:PROTEIN
Mol. Mass.:116839.55
Organism:Homo sapiens (Human)
Description:ChEMBL_107998
Residue:1050
Sequence:
MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148479
n/a
NameBDBM50148479
Synonyms:CHEMBL3770259
TypeSmall organic molecule
Emp. Form.C22H21N3O5S
Mol. Mass.439.484
SMILESCOc1ccc(Oc2cc3n(C)c(=O)n(C)c3cc2NS(=O)(=O)c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: