| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM50152136 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1565467 (CHEMBL3782136) |
|---|
| IC50 | 332±n/a nM |
|---|
| Citation |  Petrocchi, A; Leo, E; Reyna, NJ; Hamilton, MM; Shi, X; Parker, CA; Mseeh, F; Bardenhagen, JP; Leonard, P; Cross, JB; Huang, S; Jiang, Y; Cardozo, M; Draetta, G; Marszalek, JR; Toniatti, C; Jones, P; Lewis, RT Identification of potent and selective MTH1 inhibitors. Bioorg Med Chem Lett26:1503-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 2-hydroxy-dATP diphosphatase | 3.6.1.- | 3.6.1.56 | 7,8-dihydro-8-oxoguanine triphosphatase | 8-oxo-dGTPase | 8ODP_HUMAN | MTH1 | Methylated purine nucleoside triphosphate hydrolase | MutT homolog 1 protein (MTH1) | NUDT1 | Nucleoside diphosphate-linked moiety X motif 1 | Nudix motif 1 | Oxidized purine nucleoside triphosphate hydrolase [42-197] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 156 |
|---|
| Sequence: | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM50152136 |
|---|
| n/a |
|---|
| Name | BDBM50152136 |
|---|
| Synonyms: | CHEMBL3781282 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H16N4O |
|---|
| Mol. Mass. | 196.2495 |
|---|
| SMILES | CC(C)(CO)CNc1ccnc(N)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
