Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 2
LigandBDBM50155308
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1565559
Ki 2660±n/a nM
Citation FridÚn-Saxin MSeifert TMalo Mda Silva Andersson KPemberton NDyrager CFriberg ADahlÚn KWallÚn EAGr°tli MLuthman K Chroman-4-one and chromone based somatostatin▀-turn mimetics. Eur J Med Chem 114:59-64 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 2
Name:Somatostatin receptor type 2
Synonyms:SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSTR2 | Somatostatin receptor type 2 (SSTR2)
Type:Enzyme
Mol. Mass.:41344.94
Organism:Homo sapiens (Human)
Description:P30874
Residue:369
Sequence:
MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50155308
n/a
NameBDBM50155308
Synonyms:CHEMBL3780791
TypeSmall organic molecule
Emp. Form.C24H24Cl3NO2
Mol. Mass.464.812
SMILESCl.Cl.NCCCc1cc(Cl)cc2c1oc(CCc1cccc3ccccc13)cc2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: