Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50070377 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1564945 (CHEMBL3783006) |
---|
IC50 | 1.9±n/a nM |
---|
Citation | Betti, C; Starnowska, J; Mika, J; Dyniewicz, J; Frankiewicz, L; Novoa, A; Bochynska, M; Keresztes, A; Kosson, P; Makuch, W; Van Duppen, J; Chung, NN; Vanden Broeck, J; Lipkowski, AW; Schiller, PW; Janssens, F; Ceusters, M; Sommen, F; Meert, T; Przewlocka, B; Tourwé, D; Ballet, S Dual Alleviation of Acute and Neuropathic Pain by Fused Opioid Agonist-Neurokinin 1 Antagonist Peptidomimetics. ACS Med Chem Lett6:1209-14 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50070377 |
---|
n/a |
---|
Name | BDBM50070377 |
Synonyms: | CHEMBL3408519 |
Type | Small organic molecule |
Emp. Form. | C38H50N8O5 |
Mol. Mass. | 698.8542 |
SMILES | [H][C@@]1(Cc2ccccc2CN(CCC(=O)N(C)Cc2ccccc2)C1=O)NC(=O)[C@@H](CCCNC(N)=N)NC(=O)[C@@H](N)Cc1c(C)cc(O)cc1C |r| |
Structure |
|