Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase HCK
LigandBDBM50156158
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1563501
IC50 197±n/a nM
Citation Onions STIto KCharron CEBrown RJColucci MFrickel FHardy GJoly KKing-Underwood JKizawa YKnowles IMurray PJNovak ARani ARapeport GSmith AStrong PTaddei DMWilliams JG Discovery of Narrow Spectrum Kinase Inhibitors: New Therapeutic Agents for the Treatment of COPD and Steroid-Resistant Asthma. J Med Chem 59:1727-46 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase HCK
Name:Tyrosine-protein kinase HCK
Synonyms:HCK | Hematopoietic cell kinase | Hemopoietic cell kinase | p59-HCK/p60-HCK | p59Hck | p61Hck
Type:Enzyme Catalytic Domain
Mol. Mass.:59600.18
Organism:Homo sapiens (Human)
Description:P08631
Residue:526
Sequence:
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156158
n/a
NameBDBM50156158
Synonyms:CHEMBL3781244
TypeSmall organic molecule
Emp. Form.C35H39N7O3
Mol. Mass.605.7293
SMILESCN(C)CC(=O)Nc1cc(COc2ccc(NC(=O)Nc3cc(nn3-c3ccc(C)cc3)C(C)(C)C)c3ccccc23)ccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: