| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chromobox protein homolog 7 |
|---|
| Ligand | BDBM50157430 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1565742 (CHEMBL3782540) |
|---|
| IC50 | 1700±n/a nM |
|---|
| Citation |  Milosevich, N; Gignac, MC; McFarlane, J; Simhadri, C; Horvath, S; Daze, KD; Croft, CS; Dheri, A; Quon, TT; Douglas, SF; Wulff, JE; Paci, I; Hof, F Selective Inhibition of CBX6: A Methyllysine Reader Protein in the Polycomb Family. ACS Med Chem Lett7:139-44 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chromobox protein homolog 7 |
|---|
| Name: | Chromobox protein homolog 7 |
|---|
| Synonyms: | CBX7 | CBX7_HUMAN | Chromobox protein homolog 7 | Chromobox protein homolog 7 (CBX7) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28351.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 251 |
|---|
| Sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP
DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA
EGFFRDRSGKF
|
|
|
|---|
| BDBM50157430 |
|---|
| n/a |
|---|
| Name | BDBM50157430 |
|---|
| Synonyms: | CHEMBL3781271 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H53BrN7O8 |
|---|
| Mol. Mass. | 839.794 |
|---|
| SMILES | C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)c1ccc(Br)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCC[N+](C)(C)C)C(=O)N[C@@H](CO)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
