Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatocyte growth factor activator
LigandBDBM50158152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1565754
Ki 1080±n/a nM
Citation Venukadasula PKOwusu BYBansal NRoss LJHobrath JVBao DTruss JWStackhouse MMessick TEKlampfer LGalemmo RA Design and Synthesis of Nonpeptide Inhibitors of Hepatocyte Growth Factor Activation. ACS Med Chem Lett 7:177-81 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Hepatocyte growth factor activator
Name:Hepatocyte growth factor activator
Synonyms:HGF activator | HGFA | HGFAC | Hepatocyte growth factor activator | Hepatocyte growth factor activator long chain | Hepatocyte growth factor activator short chain
Type:PROTEIN
Mol. Mass.:70690.18
Organism:Homo sapiens (Human)
Description:ChEMBL_109514
Residue:655
Sequence:
MGRWAWVPSPWPPPGLGPFLLLLLLLLLLPRGFQPQPGGNRTESPEPNATATPAIPTILV
TSVTSETPATSAPEAEGPQSGGLPPPPRAVPSSSSPQAQALTEDGRPCRFPFRYGGRMLH
ACTSEGSAHRKWCATTHNYDRDRAWGYCVEATPPPGGPAALDPCASGPCLNGGSCSNTQD
PQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEGGDRWARVRQGHVEQCECFGGRTWCEGT
RHTACLSSPCLNGGTCHLIVATGTTVCACPPGFAGRLCNIEPDERCFLGNGTGYRGVAST
SASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDNDERPWCYVVKDSALSWE
YCRLEACESLTRVQLSPDLLATLPEPASPGRQACGRRHKKRTFLRPRIIGGSSSLPGSHP
WLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE
KYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGW
GHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGG
PLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIRPPRRLVAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158152
n/a
NameBDBM50158152
Synonyms:CHEMBL3780269
TypeSmall organic molecule
Emp. Form.C33H40N6O2
Mol. Mass.552.7097
SMILESNC(=N)c1cccc(c1)N1CC(CNC(=O)Cc2ccccc2)CN(CC2CCN(Cc3ccccc3)CC2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: