Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50158875
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1565801
IC50>10000±n/a nM
Citation McAllister TEEngland KSHopkinson RJBrennan PEKawamura ASchofield CJ Recent Progress in Histone Demethylase Inhibitors. J Med Chem 59:1308-29 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Amine oxidase [flavin-containing] B
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50158875
n/a
NameBDBM50158875
Synonyms:CHEMBL3787372 | US9676701, 69 N-(4′-((trans)-2-aminocyclopropyl)biphenyl-3-yl)propane-2-sulfonamide hydrochloride
TypeSmall organic molecule
Emp. Form.C18H22N2O2S
Mol. Mass.330.444
SMILESCC(C)S(=O)(=O)Nc1cccc(c1)-c1ccc(cc1)[C@H]1C[C@@H]1N |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: