Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 1A
LigandBDBM50161351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1567130
IC50>10000±n/a nM
Citation Ouach ABoulahjar RVala CBourg SBonnet PGuguen-Guillouzo CRavache MLe Guevel RLozach OLazar STroin YMeijer LRuchaud SAkssira MGuillaumet GRoutier S Novel optimization of valmerins (tetrahydropyrido[1,2-a]isoindolones) as potent dual CDK5/GSK3 inhibitors. Eur J Med Chem 115:311-25 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 1A
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 1A
Synonyms:DYRK1A | Dual specificity YAK1-related kinase | Dual specificity YAK1-related kinase 1A (Dyrk1A) | Dual specificity tyrosine-phosphorylation-regulated kinase 1A (DYRK1A) | Dual-specificity tyrosine-regulated kinases 1A | HP86
Type:Enzyme
Mol. Mass.:85616.61
Organism:Homo sapiens (Human)
Description:Q13627
Residue:763
Sequence:
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50161351
n/a
NameBDBM50161351
Synonyms:CHEMBL3785573
TypeSmall organic molecule
Emp. Form.C23H27N5O3
Mol. Mass.421.4922
SMILESO=C(Nc1cccc(CN2CCOCC2)n1)Nc1cccc2C(=O)N3CCCCC3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: