| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50161827 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1567954 (CHEMBL3789811) |
|---|
| IC50 | 55100±n/a nM |
|---|
| Citation |  Viira, B; Selyutina, A; García-Sosa, AT; Karonen, M; Sinkkonen, J; Merits, A; Maran, U Design, discovery, modelling, synthesis, and biological evaluation of novel and small, low toxicity s-triazine derivatives as HIV-1 non-nucleoside reverse transcriptase inhibitors. Bioorg Med Chem24:2519-29 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50161827 |
|---|
| n/a |
|---|
| Name | BDBM50161827 |
|---|
| Synonyms: | CHEMBL3785762 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N5O |
|---|
| Mol. Mass. | 307.3498 |
|---|
| SMILES | Cc1ccc(Nc2nc(O)nc(Nc3ccc(C)cc3)n2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
