| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50163752 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1576394 (CHEMBL3802823) |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Zhan, P; Pannecouque, C; De Clercq, E; Liu, X Anti-HIV Drug Discovery and Development: Current Innovations and Future Trends. J Med Chem59:2849-78 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50163752 |
|---|
| n/a |
|---|
| Name | BDBM50163752 |
|---|
| Synonyms: | CHEMBL3799500 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N4O6S2 |
|---|
| Mol. Mass. | 588.739 |
|---|
| SMILES | CC[C@H](C)CN(C[C@@H](O)C(Cc1ccccc1)N([C@H]1CCC(=O)N1)C(=O)OC)S(=O)(=O)c1cccc2ncsc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
