Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50069985 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1575697 (CHEMBL3804706) |
---|
IC50 | 52±n/a nM |
---|
Citation | Yang, L; Wang, W; Sun, Q; Xu, F; Niu, Y; Wang, C; Liang, L; Xu, P Development of novel proteasome inhibitors based on phthalazinone scaffold. Bioorg Med Chem Lett26:2801-2805 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50069985 |
---|
n/a |
---|
Name | BDBM50069985 |
Synonyms: | (S)-4-methyl-2-(3-phenyl-propionylamino)-pentanoic acid [(S)-1-((S)-1-formyl-3-methyl-butylcarbamoyl)-3-methyl-butyl]-amide | CHEMBL64925 | Cbz-L-leu-L-leu-L-leu-CHO | MG-13 | MG-132 | Z-L-leu-L-leu-L-leu-H | Z-Leu-Leu-Leu-H | Z-Leu-Leu-Leu-al | benzyl (S)-4-methyl-1-((S)-4-methyl-1-((S)-4-methyl-1-oxopentan-2-ylamino)-1-oxopentan-2-ylamino)-1-oxopentan-2-ylcarbamate | benzyl(S)-4-methyl-1-((S)-4-methyl-1-((S)-4-methyl-1-oxopentan-2-ylamino)-1-oxopentan-2-ylamino)-1-oxopentan-2-ylcarbamate | benzyloxycarbonyl-Leu-Leu-leucinal | {(S)-1-[(S)-1-((S)-1-Formyl-3-methyl-butylcarbamoyl)-3-methyl-butylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester | {1-[(S)-(S)-1-((S)-1-Formyl-3-methyl-butylcarbamoyl)-3-methyl-butylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester | {1-[1-(1-Formyl-3-methyl-butylcarbamoyl)-3-methyl-butylcarbamoyl]-3-methyl-butyl}-carbamic acid benzyl ester |
Type | Small organic molecule |
Emp. Form. | C26H41N3O5 |
Mol. Mass. | 475.6208 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1)C=O |r| |
Structure |
|