Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase TTK
LigandBDBM50183021
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586153
IC50 0.400000±n/a nM
Citation Laufer RLi SWLiu YNg GLang YFeher MBrokx RBeletskaya IHodgson RMao GPlotnikova OAwrey DEMason JMWei XLin DCChe YKiarash RMadeira BFletcher GCMak TWBray MRPauls HW Discovery of 4-(4-aminopyrazolo[1,5-a][1,3,5]triazin-8-yl)benzamides as novel, highly potent and selective, orally bioavailable inhibitors of Tyrosine Threonine Kinase, TTK. Bioorg Med Chem Lett 26:3562-6 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase TTK
Name:Dual specificity protein kinase TTK
Synonyms:Dual specificity protein kinase (TTK) | Dual specificity protein kinase TTK (MPS1) | MPS1 | Monopolar Spindle 1 (MPS1) | Monopolar Spindle 1 (Mps-1) | Monopolar Spindle 1 Kinase (MPS1) | Phosphotyrosine picked threonine-protein kinase (MPS1) | TTK
Type:Protein
Mol. Mass.:97086.79
Organism:Homo sapiens (Human)
Description:P33981
Residue:857
Sequence:
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183021
n/a
NameBDBM50183021
Synonyms:CHEMBL3818646
TypeSmall organic molecule
Emp. Form.C28H28F2N6O3
Mol. Mass.534.5571
SMILESCc1cc(ccc1C(=O)NC1CC1)-c1cnn2c(NCC3CCOCC3)nc(Oc3cccc(F)c3F)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: