Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM50186189 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1587252 (CHEMBL3826068) |
---|
Ki | 59±n/a nM |
---|
Citation | Li, J; Schulte, ML; Nickels, ML; Manning, HC New structure-activity relationships of N-acetamide substituted pyrazolopyrimidines as pharmacological ligands of TSPO. Bioorg Med Chem Lett26:3472-7 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
Type: | Mitochondrion membrane protein |
Mol. Mass.: | 18945.84 |
Organism: | Rattus norvegicus (rat) |
Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
Residue: | 169 |
Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
BDBM50186189 |
---|
n/a |
---|
Name | BDBM50186189 |
Synonyms: | CHEMBL3823037 |
Type | Small organic molecule |
Emp. Form. | C25H34N4O2 |
Mol. Mass. | 422.5631 |
SMILES | CCN(C(=O)Cc1c(nn2c(CC)cc(CC)nc12)-c1ccc(OC)cc1)C(C)(C)C |
Structure |
|