| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50190619 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1589519 (CHEMBL3829093) |
|---|
| Ki | 53±n/a nM |
|---|
| Citation |  Scocchera, E; Reeve, SM; Keshipeddy, S; Lombardo, MN; Hajian, B; Sochia, AE; Alverson, JB; Priestley, ND; Anderson, AC; Wright, DL Charged Nonclassical Antifolates with Activity Against Gram-Positive and Gram-Negative Pathogens. ACS Med Chem Lett7:692-6 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAU | Dihydrofolate Reductase (DHFR) | Dihydrofolate reductase | Dihydrofolate reductase (DfrB) | Tetrahydrofolate dehydrogenase | folA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18249.71 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | n/a |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM50190619 |
|---|
| n/a |
|---|
| Name | BDBM50190619 |
|---|
| Synonyms: | CHEMBL3827086 | US10870625, Compound 14 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22N4O3 |
|---|
| Mol. Mass. | 402.4458 |
|---|
| SMILES | CCc1nc(N)nc(N)c1C#CCc1cc(ccc1OC)-c1ccccc1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
