Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 2
LigandBDBM50191677
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1613137
IC50<1400±n/a nM
Citation Glatthar RStojanovic ATroxler TMattes HMöbitz HBeerli RBlanz JGassmann EDrückes PFendrich GGutmann SMartiny-Baron GSpence FHornfeld JPeel JESparrer H Discovery of Imidazoquinolines as a Novel Class of Potent, Selective, and in Vivo Efficacious Cancer Osaka Thyroid (COT) Kinase Inhibitors. J Med Chem 59:7544-60 (2016) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 2
Name:MAP kinase-interacting serine/threonine-protein kinase 1/2
Synonyms:GPRK7 | MAP kinase signal-integrating kinase 2 | MAP kinase-interacting serine/threonine-protein kinase 2 (MKNK2) | MAP kinase-interacting serine/threonine-protein kinase 2 (MnK2) | MAP-kinase interacting kinase 2 (MNK2) | MKNK2 | MNK2
Type:Protein
Mol. Mass.:51870.79
Organism:Homo sapiens (Human)
Description:Q9HBH9
Residue:465
Sequence:
MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAK
KRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50191677
n/a
NameBDBM50191677
Synonyms:CHEMBL3910848
TypeSmall organic molecule
Emp. Form.C22H13N5S
Mol. Mass.379.437
SMILESc1cc(cs1)-c1cc2c3n(cnc3cnc2cn1)-c1ccc2ncccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: