Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50193451 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1615946 (CHEMBL3858015) |
---|
Ki | 4400±n/a nM |
---|
Citation | Zampieri, D; Vio, L; Fermeglia, M; Pricl, S; Wünsch, B; Schepmann, D; Romano, M; Mamolo, MG; Laurini, E Computer-assisted design, synthesis, binding and cytotoxicity assessments of new 1-(4-(aryl(methyl)amino)butyl)-heterocyclic sigma 1 ligands. Eur J Med Chem121:712-726 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
Type: | Protein |
Mol. Mass.: | 25307.17 |
Organism: | Cavia porcellus (Guinea pig) |
Description: | Q60492 |
Residue: | 223 |
Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
BDBM50193451 |
---|
n/a |
---|
Name | BDBM50193451 |
Synonyms: | CHEMBL3912537 |
Type | Small organic molecule |
Emp. Form. | C20H23ClN2 |
Mol. Mass. | 326.863 |
SMILES | CN(CCCCn1ccc2ccccc12)Cc1ccc(Cl)cc1 |
Structure |
|