Reaction Details |
| Report a problem with these data |
Target | Dipeptidyl peptidase 1 |
---|
Ligand | BDBM50195235 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1617581 (CHEMBL3859650) |
---|
IC50 | 20±n/a nM |
---|
Citation | Connolly, S; Lönn, H; Käck, H; Van de Poël, A; Dahl, G; Doyle, K; Gardiner, P; Root, J; Wikell, C; Johannesson, P; Stenvall, K; Swallow, S Discovery of Second Generation Reversible Covalent DPP1 Inhibitors Leading to an Oxazepane Amidoacetonitrile Based Clinical Candidate (AZD7986). J Med Chem59:9457-9472 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dipeptidyl peptidase 1 |
---|
Name: | Dipeptidyl peptidase 1 |
Synonyms: | CATC_RAT | Cathepsin C | Cathepsin J | Ctsc | DPP-I | DPPI | Dipeptidyl peptidase 1 | Dipeptidyl peptidase 1 exclusion domain chain | Dipeptidyl peptidase 1 heavy chain | Dipeptidyl peptidase 1 light chain | Dipeptidyl peptidase I | Dipeptidyl peptidase I exclusion domain chain | Dipeptidyl peptidase I heavy chain | Dipeptidyl peptidase I light chain | Dipeptidyl transferase |
Type: | PROTEIN |
Mol. Mass.: | 52238.74 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_109229 |
Residue: | 462 |
Sequence: | MGPWTHSLRAALLLVLLGVCTVSSDTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPT
EEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHE
TMTGWVHDVLGRNWACFVGKKMANHSEKVYVNVAHLGGLQEKYSERLYSHNHNFVKAINS
VQKSWTATTYEEYEKLSIRDLIRRSGHSGRILRPKPAPITDEIQQQILSLPESWDWRNVR
GINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGG
FPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMK
LELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGKDPVTGLD
YWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL
|
|
|
BDBM50195235 |
---|
n/a |
---|
Name | BDBM50195235 |
Synonyms: | CHEMBL3900409 | US10287258, Example 2 | US10669245, Example 2 | US11117874, Example 2 | US11655221, Example 2 | US11680049, Example 2 | US20230278969, Example 2 |
Type | Small organic molecule |
Emp. Form. | C23H24N4O4 |
Mol. Mass. | 420.4611 |
SMILES | Cn1c2cc(ccc2oc1=O)-c1ccc(C[C@H](NC(=O)[C@@H]2CNCCCO2)C#N)cc1 |r| |
Structure |
|