| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E synthase |
|---|
| Ligand | BDBM50135226 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1619471 (CHEMBL3861640) |
|---|
| IC50 | 60±n/a nM |
|---|
| Citation |  Park, EB; Kim, KJ; Jeong, HR; Lee, JK; Kim, HJ; Lee, HH; Lim, JW; Shin, JS; Koeberle, A; Werz, O; Lee, KT; Lee, JY Synthesis, structure determination, and biological evaluation of phenylsulfonyl hydrazide derivatives as potential anti-inflammatory agents. Bioorg Med Chem Lett26:5193-5197 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E synthase |
|---|
| Name: | Prostaglandin E synthase |
|---|
| Synonyms: | 5.3.99.3 | Microsomal prostaglandin E synthase 1 | PTGES_MOUSE | Pges | Prostaglandin E synthase | Ptges | mPGES-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17293.88 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_104562 |
|---|
| Residue: | 153 |
|---|
| Sequence: | MPSPGLVMESGQVLPAFLLCSTLLVIKMYAVAVITGQMRLRKKAFANPEDALKRGGLQYY
RSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLG
KLNPRLRSGAYVLAQFSCFSMALQILWEVAHHL
|
|
|
|---|
| BDBM50135226 |
|---|
| n/a |
|---|
| Name | BDBM50135226 |
|---|
| Synonyms: | CHEMBL3747473 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H24N2O6S |
|---|
| Mol. Mass. | 504.554 |
|---|
| SMILES | COc1ccc(cc1)S(=O)(=O)N(Nc1ccccc1)C(=O)Oc1ccc(OCc2ccccc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
