| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Outer membrane protein MIP |
|---|
| Ligand | BDBM50200283 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1622004 (CHEMBL3864356) |
|---|
| IC50 | 5754±n/a nM |
|---|
| Citation |  Seufert, F; Kuhn, M; Hein, M; Weiwad, M; Vivoli, M; Norville, IH; Sarkar-Tyson, M; Marshall, LE; Schweimer, K; Bruhn, H; Rösch, P; Harmer, NJ; Sotriffer, CA; Holzgrabe, U Development, synthesis and structure-activity-relationships of inhibitors of the macrophage infectivity potentiator (Mip) proteins of Legionella pneumophila and Burkholderia pseudomallei. Bioorg Med Chem24:5134-5147 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Outer membrane protein MIP |
|---|
| Name: | Outer membrane protein MIP |
|---|
| Synonyms: | MIP_LEGPN | Macrophage infectivity potentiator | PPIase | Peptidyl-prolyl cis-trans isomerase | Rotamase | mip |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24869.94 |
|---|
| Organism: | Legionella pneumophila |
|---|
| Description: | ChEMBL_701873 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAK
GMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPG
VVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIP
GWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
|
|
|
|---|
| BDBM50200283 |
|---|
| n/a |
|---|
| Name | BDBM50200283 |
|---|
| Synonyms: | CHEMBL3924013 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H26N2O4S |
|---|
| Mol. Mass. | 402.507 |
|---|
| SMILES | O=C(OCCCc1cccnc1)[C@@H]1CCCCN1S(=O)(=O)Cc1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
