Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnhancer of zeste homolog 1 (EZH1)
LigandBDBM50205628
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1628507
IC50 7750±n/a nM
Citation Ansari ASatalkar SPatil VShete ASKaur SGupta ASingh SRaja MSeverance DLBernales SChakravarty SHung DTPham SMHerrera FJRai R Novel 3-methylindoline inhibitors of EZH2: Design, synthesis and SAR. Bioorg Med Chem Lett 27:217-222 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enhancer of zeste homolog 1 (EZH1)
Name:Enhancer of zeste homolog 1 (EZH1)
Synonyms:ENX-2 | EZH1 | Enhancer of zeste homolog 1 | Histone-lysine N-methyltransferase EZH1 | KIAA0388
Type:Protein
Mol. Mass.:85285.34
Organism:Homo sapiens (Human)
Description:Q92800
Residue:747
Sequence:
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205628
n/a
NameBDBM50205628
Synonyms:CHEMBL3906288
TypeSmall organic molecule
Emp. Form.C22H26N4O2
Mol. Mass.378.4674
SMILESCC(C)N1CC(C)c2c1cc(cc2C(=O)NCc1c(C)cc(C)[nH]c1=O)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: