Reaction Details |
| Report a problem with these data |
Target | Monoacylglycerol lipase ABHD6 |
---|
Ligand | BDBM50211257 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1636272 (CHEMBL3879170) |
---|
IC50 | 79±n/a nM |
---|
Citation | Deng, H; Kooijman, S; van den Nieuwendijk, AM; Ogasawara, D; van der Wel, T; van Dalen, F; Baggelaar, MP; Janssen, FJ; van den Berg, RJ; den Dulk, H; Cravatt, BF; Overkleeft, HS; Rensen, PC; van der Stelt, M Triazole Ureas Act as Diacylglycerol Lipase Inhibitors and Prevent Fasting-Induced Refeeding. J Med Chem60:428-440 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Monoacylglycerol lipase ABHD6 |
---|
Name: | Monoacylglycerol lipase ABHD6 |
Synonyms: | ABHD6_MOUSE | Abh6 | Abhd6 | Abhydrolase Domain-Containing Protein 6 | Monoacylglycerol lipase ABHD6 |
Type: | Single-pass type II membrane protein; hydrolase |
Mol. Mass.: | 38216.17 |
Organism: | Mus musculus (mouse) |
Description: | Assays were using membranes of recombinant Abh6 transiently transfected in COS-7 cells. |
Residue: | 336 |
Sequence: | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
|
|
|
BDBM50211257 |
---|
n/a |
---|
Name | BDBM50211257 |
Synonyms: | CHEMBL3895863 | US10583137, Compound 14 |
Type | Small organic molecule |
Emp. Form. | C31H28F2N4O3 |
Mol. Mass. | 542.5758 |
SMILES | OC(c1cnn(n1)C(=O)N1C[C@@H](CC[C@@H]1Cc1ccccc1)OCC#C)(c1ccc(F)cc1)c1ccc(F)cc1 |r| |
Structure |
|