| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50081910 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53931 (CHEMBL669353) |
|---|
| pH | 7.2±n/a |
|---|
| Ki | 1660±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Li, R; Hansch, C; Kaufman, BT A comparison of the inhibitory action of 5-(substituted-benzyl)-2,4-diaminopyrimidines on dihydrofolate reductase from chicken liver with that from bovine liver. J Med Chem25:435-40 (1982) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21603.71 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P00376 |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
|---|
| BDBM50081910 |
|---|
| n/a |
|---|
| Name | BDBM50081910 |
|---|
| Synonyms: | 5-(3-Octyloxy-benzyl)-pyrimidine-2,4-diamine | CHEMBL31235 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H28N4O |
|---|
| Mol. Mass. | 328.4518 |
|---|
| SMILES | CCCCCCCCOc1cccc(Cc2cnc(N)nc2N)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
