Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50405984 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_53931 (CHEMBL669353) |
---|
pH | 7.2±n/a |
---|
Ki | 2630±n/a nM |
---|
Comments | extracted |
---|
Citation | Li, R; Hansch, C; Kaufman, BT A comparison of the inhibitory action of 5-(substituted-benzyl)-2,4-diaminopyrimidines on dihydrofolate reductase from chicken liver with that from bovine liver. J Med Chem25:435-40 (1982) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
Type: | Enzyme |
Mol. Mass.: | 21603.71 |
Organism: | Bos taurus (Cattle) |
Description: | P00376 |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
BDBM50405984 |
---|
n/a |
---|
Name | BDBM50405984 |
Synonyms: | CHEMBL434787 |
Type | Small organic molecule |
Emp. Form. | C12H14N4O3S |
Mol. Mass. | 294.33 |
SMILES | CS(=O)(=O)Oc1cccc(Cc2cnc(N)nc2N)c1 |
Structure |
|