| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50212289 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_211321 (CHEMBL818980) |
|---|
| IC50 | 7700±n/a nM |
|---|
| Citation |  Getahun, Z; Jurd, L; Chu, PS; Lin, CM; Hamel, E Synthesis of alkoxy-substituted diaryl compounds and correlation of ring separation with inhibition of tubulin polymerization: differential enhancement of inhibitory effects under suboptimal polymerization reaction conditions. J Med Chem35:1058-67 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50212289 |
|---|
| n/a |
|---|
| Name | BDBM50212289 |
|---|
| Synonyms: | CHEMBL10121 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H20O5 |
|---|
| Mol. Mass. | 304.3377 |
|---|
| SMILES | COc1ccc(Cc2cc(OC)c(OC)c(OC)c2)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
