| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50231596 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1645466 (CHEMBL3994395) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Koul, S; Ramdas, V; Barawkar, DA; Waman, YB; Prasad, N; Madadi, SK; Shejul, YD; Bonagiri, R; Basu, S; Menon, S; Reddy, SB; Chaturvedi, S; Chennamaneni, SR; Bedse, G; Thakare, R; Gundu, J; Chaudhary, S; De, S; Meru, AV; Palle, V; Chugh, A; Mookhtiar, KA Design and synthesis of novel, potent and selective hypoxanthine analogs as adenosine A Bioorg Med Chem25:1963-1975 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | A3 adenosine receptor (hA3) | AA3R_HUMAN | ADORA3 | Adenosine A3 receptor (A3AR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36197.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P0DMS8 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
|
|
|
|---|
| BDBM50231596 |
|---|
| n/a |
|---|
| Name | BDBM50231596 |
|---|
| Synonyms: | CHEMBL4074150 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20F2N4O2 |
|---|
| Mol. Mass. | 374.3845 |
|---|
| SMILES | CCCn1c(Oc2ccc(F)c(F)c2)nc2nc([nH]c2c1=O)C1CCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
