Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein kinase CLK1/CLK4
LigandBDBM50234810
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1653990
IC50 40±n/a nM
Citation Murár MDobia? J?ramel PAddová GHanquet GBohác A Novel CLK1 inhibitors based on N-aryloxazol-2-amine skeleton - A possible way to dual VEGFR2 TK/CLK ligands. Eur J Med Chem 126:754-761 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein kinase CLK1/CLK4
Name:Dual specificity protein kinase CLK1/CLK4
Synonyms:CDC-like kinase 1 | CDC-like kinase 1 (CLK1) | CDC2-like kinase 1 (CLK1) | Dual specificity protein kinase CLK1
Type:Protein
Mol. Mass.:57322.21
Organism:Homo sapiens (Human)
Description:P49759
Residue:484
Sequence:
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50234810
n/a
NameBDBM50234810
Synonyms:CHEMBL4065167
TypeSmall organic molecule
Emp. Form.C20H20N2O4S
Mol. Mass.384.449
SMILESCCS(=O)(=O)c1ccc(OC)c(Nc2ncc(\C=C\c3ccccc3)o2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: