Reaction Details |
| Report a problem with these data |
Target | Vitamin K epoxide reductase complex subunit 1 |
---|
Ligand | BDBM50235668 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1657647 (CHEMBL4007117) |
---|
Ki | 50±n/a nM |
---|
Citation | Montagut-Romans, A; Boulven, M; Jacolot, M; Moebs-Sanchez, S; Hascoët, C; Hammed, A; Besse, S; Lemaire, M; Benoit, E; Lattard, V; Popowycz, F Synthesis and biological evaluation of C-3 aliphatic coumarins as vitamin K antagonists. Bioorg Med Chem Lett27:1598-1601 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Vitamin K epoxide reductase complex subunit 1 |
---|
Name: | Vitamin K epoxide reductase complex subunit 1 |
Synonyms: | VKOR1_RAT | Vitamin K epoxide reductase complex subunit 1 (rVKORC1) | Vkorc1 |
Type: | Enzyme |
Mol. Mass.: | 17793.51 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q6TEK4 |
Residue: | 161 |
Sequence: | MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYL
AWILFFVLYDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP
|
|
|
BDBM50235668 |
---|
n/a |
---|
Name | BDBM50235668 |
Synonyms: | CHEMBL4098946 |
Type | Small organic molecule |
Emp. Form. | C29H46O3 |
Mol. Mass. | 442.6737 |
SMILES | CC(C)CCCC(C)CCCC(C)CCCC(C)CCc1c(O)c2ccccc2oc1=O |
Structure |
|