Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
LigandBDBM50238419
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1663234
EC50 19953±n/a nM
Citation Thomson DWWagner AJBantscheff MBenson REDittus LDuempelfeld BDrewes GKrause JMoore JTMueller KPoeckel DRau CSalzer EShewchuk LHopf CEmery JGMuelbaier M Discovery of a Highly Selective Tankyrase Inhibitor Displaying Growth Inhibition Effects against a Diverse Range of Tumor Derived Cell Lines. J Med Chem 60:5455-5471 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
Name:Nicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50238419
n/a
NameBDBM50238419
Synonyms:CHEMBL4060134
TypeSmall organic molecule
Emp. Form.C24H22N10O2
Mol. Mass.482.4973
SMILESCn1cnc(c1)C(=O)N1CCN(CC1)C(=O)c1ccc(Nc2nc3ccccc3n3nnnc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: